PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do004790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 643aa    MW: 68120.3 Da    PI: 9.2892
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do004790.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.31.7e-13166227162
                 XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                 e++ +r+ r+++NRe+A+ sRqRKk ++eeLeekvk++ +   +L +++  +  e a+l+++
  Do004790.1 166 EEDKRRTARLMRNRESAQLSRQRKKRYVEELEEKVKSMHSVINDLNSKITFIAAENATLRQQ 227
                 5677899**********************************99*******999999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-14165230IPR004827Basic-leucine zipper domain
PfamPF001701.7E-11167228IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.094168228IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.5E-16170228No hitNo description
SuperFamilySSF579591.0E-11170228No hitNo description
CDDcd147041.36E-19171222No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 643 aa     Download sequence    Send to blast
MAEPALLDLR HYPAHLFDPD FPLAGGDLPL DFAGDDDLDF DLPVDFSVDD FLLRSPDRGV  60
DGDDSGEGSA AGSGPAASSS ASPATSAANS AGDREVKHED SDEGRSGAAP NWSLKRKQAS  120
PGASSDGAKC RRSGDGDLSP SASASASASR AAAAEDSDER GAGGEEEDKR RTARLMRNRE  180
SAQLSRQRKK RYVEELEEKV KSMHSVINDL NSKITFIAAE NATLRQQLGG GGVSGPPPGV  240
YPPPPLPGIH FPWVPGYAMR PHGSHVPLVP IPRLKPQQTA AAVKASKKPE VKKTVENKSK  300
TKTKKVASVS FLGLLFVALV FGAFVPGFNH NFGMGDRSDN VMFGNFGHSD ARVFSVTNHG  360
KGPKGGLNSS NMIDTDPAMM TGNADGAGQK HRPAHNSSET LPALLYVPRN GKHVKINGNL  420
IIHSVLASEK AVAHRASNGQ SVKDHKETSV AIARYLSPSG KDMNSKETFP PDAPLPQWFR  480
EGMEGNSFAL TSSIQTSSYV MCEVFQFDIS ASPAKSGGII PGSPTVNSSS VNATQKIPSG  540
KLKNRRIMYN KAIPLPGKTV NNTEARAFNS TSESSKVPDS KPASSVVVSV LADPREAGNG  600
DVDPRVSPKP LSKIFVVVLV DGVRYVTYSC TLPFKSASPH LVN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1168190KRRTARLMRNRESAQLSRQRKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962093.10.0PREDICTED: bZIP transcription factor 17-like
TrEMBLK3Z4H40.0K3Z4H4_SETIT; Uncharacterized protein
STRINGSi021442m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82283545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.12e-78bZIP family protein